PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA11477
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB_related
Protein Properties Length: 279aa    MW: 31347.5 Da    PI: 8.2972
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA11477genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-1380122246
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +++T eE++l+v++++  G++ W+ Ia+ ++ gRt++++k+ w++
  Tp57577_TGAC_v2_mRNA11477  80 DNFTSEEEDLIVKLHAAIGSR-WSIIAQQLP-GRTDNDVKNNWNT 122
                                68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.45E-1660132IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-46086IPR009057Homeodomain-like
PROSITE profilePS5129420.72174128IPR017930Myb domain
SMARTSM007174.2E-1178126IPR001005SANT/Myb domain
CDDcd001673.38E-881124No hitNo description
PfamPF002496.3E-1281122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-1887125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
ITWLGLQVVK KPVSSKAVYG SQKTMQRHLR LYRSMVLVIG LLSPKKQISS REEYVYAGVK  60
RCGKSCRLRL SSYIPDLKHD NFTSEEEDLI VKLHAAIGSR WSIIAQQLPG RTDNDVKNNW  120
NTKLKKKLSQ MGIDPVTHKP FSKLIADYGN IGATTTATDS QQRLIRNTND RSMQLRTKME  180
TSMFEEGCLS STLSTSSACS STSTQGTTFV APFSWNDFLT EDANFAAPSN NLQEEQYLEK  240
KKEVMSSSSD VSFVEAILDQ ENEMFLSFPE LLEEPSNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-166112840108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00148DAPTransfer from AT1G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013459501.15e-98myb transcription factor
TrEMBLA0A072UV816e-98A0A072UV81_MEDTR; Myb transcription factor
STRINGGLYMA06G20020.23e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-35MYB family protein